90
|
scanalytics inc
iplab software Iplab Software, supplied by scanalytics inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/planning+and+segmentation+software+iplan+2%2E6/iplab+software/pmc02063706-211-26-30 Average 90 stars, based on 1 article reviews
iplab software - by Bioz Stars,
2026-10
90/100 stars
|
Buy from Supplier |
N/A
|
Lenti ORF clone of Human phospholipase A2 group VI cytosolic calcium independent PLA2G6 transcript variant 2 Myc DDK tagged
|
Buy from Supplier |
N/A
|
Standard format: Plasmid sent in bacteria as agar stab
|
Buy from Supplier |
N/A
|
Standard format: Plasmid sent in bacteria as agar stab
|
Buy from Supplier |
N/A
|
Lenti ORF particles Pnpla8 GFP tagged Mouse patatin like phospholipase domain containing 8 Pnpla8 200ul 10 7 TU mL
|
Buy from Supplier |
N/A
|
Pnpla8 untagged Mouse patatin like phospholipase domain containing 8 Pnpla8 10ug
|
Buy from Supplier |
N/A
|
Periplakin antibody was raised using the middle region of PPL corresponding to a region with amino acids EKSRAQEKVTEKEVVKLQNDPQLEAEYQQLQEDHQRQDQLREKQEEELSF. Rabbit polyclonal Periplakin antibody raised against the middle region of PPL.
|
Buy from Supplier |
N/A
|
Standard format: Plasmid sent in bacteria as agar stab
|
Buy from Supplier |
N/A
|
Lenti ORF particles PLA2G6 mGFP tagged Human phospholipase A2 group VI cytosolic calcium independent PLA2G6 transcript variant 2 200ul 10 7 TU mL
|
Buy from Supplier |